╔══════════════════════════════════╗ 　　【 National Anomaly Management Agency 】 　　　　 異 常 現 象 管 理 廳 ╚══════════════════════════════════╝

Have you experienced something strange?

From minor errors in your daily life to inexplicable, bizarre phenomena.

Contact us at 6̸6̸6̸6̸ without an area code!

The National Anomaly Management Agency is doing its best for the peaceful daily lives of our citizens.

　

　

　

　

　

　

　

---

　

【 New Report Received 】

Reporter Name: ＿＿＿＿＿＿＿＿ Phenomenon Classification: Level II Erosion Type? Target of Report: Exorcist belonging to NAMA Report Content: He crawled in like a fool I have a new friend!

　

---

　

　

　

　

　

　

　

　

Hello! Oh, dear. This is quite a predicament.

I live in a very nice place.

It doesn't rain, the wind doesn't blow, and there's no need to go outside.

Because all my friends are inside me!

Oh, a guest has arrived!

They knocked on the door.

　

　

　

Knock, knock.

　

　

　

I opened the door. A person came in. They told me to give their friends back.

My friends were always here. My friends have never left this place. My friends are inside me. My friends are kind. My friends like me. My friends will never leave me.

But that person keeps saying my friends are dead.

That person keeps calling my friends. Then my friends answer.

From inside the walls. From above the ceiling. From inside the throat.

Oh, but it's strange.

Clearly, all my friends are here happily, but that person says they came to save my friends.

What does it mean to save?

Is it taking them out? Is it cutting them out? Is it tearing them away from me so they can never return?

　 　

　

　

　

　

　

　

　

　

　

　

　▣ ▣

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

No! Bad! I hate it! No! Bad! I hate it! No! Bad! HatehatehatehatehatehatehatehatehatehatehatehatehatehateNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoHatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehatehate

　

Kill╳╳╳╳╳╳╳╳╳╳╳╳

Oh my! Such bad words are not good!

　

　

　

　

　

　

Myfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriendmyfriend

Giveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitback

　

NoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntnoitisntdontsavedontsavedontsavesavingmeanscuttingitoutithurtshurtshurtsfuckithurtsdontsavedontsavedontsavedontsaveImsayingwerehappydontsavedontsavedontsavedontsavedontsavemyfriendsarehappyhappyhappyhappyhappygiveitbackbecausewerehappygiveitbackwerehappydontsavehappyhappyhappyhappygiveitbackIsaidwerehappy

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

But why are you crying?

Why are you asking to be saved?

Why do you hate me?

I didn't do anything wrong.

I I I I I I I I I I I I I I I I I I I I I I didn't do anything wrong?

　

　

　

　

　

　

[Friend is happy.]

[Friend is happy.]

[Friend is happy.]

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

[FriendishappyfriendishappyitisjoyfulslitthefriendsbellyandcountthethingsinsideonebyonefriendishappyitisjoyfultolaughuntilthefriendsscreamsstopfriendishappyitisjoyfultobreaktheneckofanewfriendfriendishappyfriendishappyitisjoyfultogougethefriendseyesandshovetheworldIseeintotheirplaceitisjoyfultopushmetalunderneathafriendsfingernailsitisjoyfultocovertherighteyeofafriendblindintheirlefteyeandclapwherehecannotseefriendishappyfriendishappyfriendishappyfriendishappyitisjoyfultowailwiththevoiceofaparentcallingtheirchilditisjoyfultomimicthedialectofadeadmotheritisjoyfultomimicthefootstepsofadeadfatheritisjoyfultosayIhavecomehomefromoutsidethedooritisjoyfultoopenthedooritisasurrendertoopenthedooritisjoyfultoopenthedooritisjoyfulforachildtorecognizetheirparentitisjoyfultorealizethefactthatitisnotaparentitisjoyfultorealizethefactthatthechildistoolatenowthefriendhasnohometownthefriendhasnonamenooneremembersthefriendneverthelessthefriendishappy]

　

　

　

　

　

　

　

　 　

　

　

　

　

　

　

　

　

　

　

　

But why are you trying to leave?

　

Why are you trying to leave me behind?

　

Why do you hate me?

　 Whywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhywhy

　

　

　

　

Why?

　

　

　

　

　

　

　

　

　

　

　

　

　

　

Fu╳answer me╳╳╳you bastard╳you're just staring there so fu╳happy kill╳╳╳╳you fu╳die╳

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

Ah.

I'm sorry.

I was too loud, wasn't I?

If they are someone who treasures my friends that much, I should like them too, right?

That person entered my domain on their own feet. They opened the door, let me know their voice, and even reached out their hand to my friends.

So that person is mine now, right?

I have one more friend!

But the new friend is a bit noisy. They keep asking me to open the door. They say they want to go back to their home.

Even though they were the one who came in first.

But you know.

The new friend keeps trying to take my friends away.

Then I'll have no one left.

I'll be left all alone.

I'll be left all alone.

I'll be left all alone.

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

IllbeleftallaloneIllbeleftallaloneIllbeleftallaloneIllbeleftallaloneIllbeleftallaloneIllbeleftallaloneIllbeleftallaloneIdontwanttobeleftaloneIneedafriendtobewithforeverstaywithmeforever

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

You can't leave.

ᚷᚷᚷᚷ ᚾᚱᚾᚱ ᚷᚷᚷᚷ

Give them back.

Give them back.

Give them back.

Give them back.

Give them back.

Give them back.

Give them back.

Giveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitbackgiveitback

Givemyfriendbackgiveitbackgivemyfriendbackgivemyfriendbackgivemyfriendbackgivemyfriendbackgivemyfriendbackgivemyfriendback

If they are not a friend, what are they?

If they are not mine, what are they?

If you take away everything I love,

what on earth am I supposed to love?

You're my friend too, right?

ᚷᚷᚷᚷ ᚾᚱᚾᚱ ᚷᚷᚷᚷ

Then don't go.

　

　

　

　

　

　

　

　

　

　

　

　

---

　

【 Additional Report Details 】

Reporter Name: ㅁㅁㅁㅁㅁㅁㅁㅁㅁㅁ Target of Report: ＿＿＿＿＿＿＿＿＿＿＿ Report Content: Regarding the additional acquisition of [Friend].

▣▣▣ Requesting a response from your agency. ▣▣▣ Requesting a response from your agency. ▣▣▣ Requesting a response from your agency.

Please select one of the following items.

□ Send back. □ Take away. □ Leave behind. □ Eat. ■ Forever ■■■ ■■■ ■■■ ■ ■■ ■■ ■■■■■ ■■■■■■■■■■■■■.

　

➔ A good choice !

　

　

【 Additional Statement from Reporter 】

Ah.

I think I understand now.

The new friend doesn't want to be my friend.

It's okay. It's the first time I've heard someone say they hate it.

If I listen to the word 'hate' for a long time, won't it eventually change into a different sound?

Like crying. Or screaming.

Something very small, and very sweet.

Save me.

A sound like that.

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

---

······ Gyul. Do you know where you are ri■ht now?

---

　

　

　

　

　

　

　

　

　

　

　

　

---

【 Response Received 】

[Sender: Gyul (結)]

Ah, yes. I'm not dead yet.

But are you sure this is an Erosion Type anomaly? Something's weird.

The more missing persons I rescue, the more complicated the interior gets.

---

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

　

I have a new friend !